PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009120773.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ARF
Protein Properties Length: 1191aa    MW: 131668 Da    PI: 7.009
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009120773.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.55.1e-23127228199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++i+r++++r++lt+GW+ Fv+ ++L +gD+v+F +  + +
  XP_009120773.1 127 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIFRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFVR--DGK 218
                     99*****************************98888885.9************************************************5..468 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     ++l+++++r+
  XP_009120773.1 219 GQLLLGIRRA 228
                     889****997 PP

2Auxin_resp117.41.2e-38253335183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g+sdldpvrW+nS+Wr+L+
  XP_009120773.1 253 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 335
                     799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.09E-42117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.8E-42121242IPR015300DNA-binding pseudobarrel domain
CDDcd100173.59E-20126227No hitNo description
PROSITE profilePS5086312.308127229IPR003340B3 DNA binding domain
SMARTSM010192.9E-23127229IPR003340B3 DNA binding domain
PfamPF023624.7E-21127228IPR003340B3 DNA binding domain
PfamPF065071.0E-33253335IPR010525Auxin response factor
PfamPF023093.2E-910621150IPR033389AUX/IAA domain
PROSITE profilePS5174526.17410641157IPR000270PB1 domain
SuperFamilySSF542771.08E-810771142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1191 aa     Download sequence    Send to blast
MKAPSSNGVS PNPMEGERRN INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK  60
QTDFIPSYPN LPSKLICMLQ NVTLNADPET EEVYAQMTLQ PVNKYDRDAL LASDMGLKIN  120
RQPNEFFCKT LTASDTSTHG GFSVPRRAAE KIFPALDFSM QPPCQELVAK DIHDNTWTFR  180
HIFRGQPKRH LLTTGWSVFV STKRLFAGDS VLFVRDGKGQ LLLGIRRANR QQPALSSSVI  240
SSDSMHIGVL AAAAHANANN SPFTIFYNPR AAPAEFVVPL AKYTKAMYAQ VSLGMRFRMI  300
FETEECGVRR YMGTVTGISD LDPVRWKNSQ WRNLQIGWDE SAAGDRPSRV SVWDIEPVLT  360
PFYICPPPFF RPRFAGQPGM PDDGTDMESA LKRAMPWLDN GLEMKDPSST IFPGLSLVQW  420
MSMQQQNGGQ VPSSAGFFPS MVSPTAAMHN SLGGADDQSK LVSFQTPPGG ISSSNLQFNK  480
PNLQGAMSQL PQPPTTLSQQ QQLQQLLHSS LNHQQSQPQQ QPQSHQQQQQ QPQSLHQQQQ  540
QQSLLLQQQQ QQQQSLQQHH QQQLQQHHQQ PLQQQTQQQQ LQQQQQQLRA QQLQSHTHPQ  600
PQQSPPHPQP QSHPQQLQPH KLQQFQLPQN QLYNGQPAVQ QHQSQQASMH HLQSQVVSGS  660
IASSVIAPPS SSLNQSFQQQ QQQSTQLQHT HRHIGASTSQ SSVIETSKSS SNLMSIPPQD  720
TQFSRQMEQQ QPPGPVQGHN QQTLVQQKAQ QSQVQQIFQQ SLLEQPHLQF QLLQRLQQQQ  780
QQQQQFLSPG SSSLPSQLLH QQLQSQQFPQ LPSPSQVQQF PSSCTNTGLP SLQPPQTLVS  840
RPQDKQNPPV GGGAKAYSGI TDGGDAPSSS TSPSTNNCQI SSSTFLNRSQ SGPAILIPDP  900
AVDVSGSLVQ DLYSKSDMRL KHELVSQQKP KASLTDHQLE ASASGTSYGL DGGENNRQQN  960
FLSPNFGLDG DSRNSLFGGA ANVENGFVPD TLLSRGYDSQ KDLQNMLSNY GGVPNVIGTE  1020
MSTSAVRTQS FGIPNVPAIS NDIAVNDAGV LGGGLWPTQT QRMRTYTKVQ KRGSVGRSID  1080
VNRYRGYDEL RHDLARMFGI EGQLEDPLTS DWKLVYVDHE NDILLVGDDP WEEFVNCVQS  1140
IKILSSAEVQ QMSLDGNFAG LPATNQACSG GDNGNGWRGQ YDDNSATSFN R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1652135651388Auxin response factor 5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.181520.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794690.0JN979469.1 Brassica rapa subsp. pekinensis auxin response factor 7-1 (ARF7-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009120773.10.0PREDICTED: auxin response factor 7
TrEMBLM4CDP60.0M4CDP6_BRARP; Auxin response factor
STRINGBra002327.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein